fchan control panel
Thread List
Toggle Frames
Collapsible threads

[ f / m / h / s / toon / a / ah / c ] - [ artist / crit / b ] - [ dis / req / faq ] - [Manage]
[ Home / Rules ] - [ Chat: IRC / Web ]
[ Default ] [Dark] [Lite] [Only Images]

Posting mode: Reply
Non-pornographic furry pictures. This board should be worksafe at all times.

(for deletion)

  • Supported file types are: GIF, JPG, PNG, SWF
  • Maximum file size allowed is 12000 KB.
  • Read the Rules Open DNP in a popup window. and check the DNP list Open Rules in a popup window..

Reply reply to thread or open thread in full viewFlash thread contains an swf fileExpand/Shrink expand/shrink threadLink link to this post in full thread view
Quick-Reply reply to this post in the quick reply windowReply to this post reply to this post in full thread view Report report this post to the moderators

[-] [+] No.38341
Furry Screenshots 27 
File: samurai_pizza_cats.jpg -(47877 B, 600x337)
47877 47877 No.38341 38341 1

Previous Thread: http://fchan.us/c/res/36081.html

File: tumblr_ngamxpnvQP1sxudx7o1_1280.png -(1037302 B, 919x703)
1037302 1037302 No.38347 - Link Reply Report 38347 2
File: Chibi_Kyubi.png -(1343327 B, 1916x1080)
1343327 1343327 No.38349 - Link Reply Report 38349 2
File: c_1476167701709.png -(215894 B, 500x384)
215894 215894 No.38353 - Link Reply Report 38353 2


File: tumblr_mtsr24kkRr1sxudx7o1_500.png -(200236 B, 500x382)
200236 200236 No.38354 - Link Reply Report 38354 2


File: Starfox_Adventures_ending_scene.jpg -(125777 B, 1088x1006)
125777 125777 No.38356 - Link Reply Report 38356 2
File: porn_now1.jpg -(223646 B, 854x480)
223646 223646 No.38361 - Link Reply Report 38361 2
File: porn_now2.jpg -(203637 B, 854x480)
203637 203637 No.38362 - Link Reply Report 38362 2
File: porn_now3.jpg -(186622 B, 854x480)
186622 186622 No.38363 - Link Reply Report 38363 2
File: Lola_Bunny.png -(1281025 B, 1366x768)
1281025 1281025 No.38364 - Link Reply Report 38364 2
File: 老婆堵嘴1.png -(347850 B, 688x516)
347850 347850 No.38371 - Link Reply Report 38371 2
File: 老婆堵嘴2.png -(395308 B, 688x516)
395308 395308 No.38372 - Link Reply Report 38372 2
No.38373 - Link Reply Report 38373 2


Source on these?

File: CAgBP_AU0AAwOQZ.png -(263468 B, 600x450)
263468 263468 No.38382 - Link Reply Report 38382 2

>>38373 Looks like a chinese cartoon
This is Candy from Andersen Monogatary.
Yes, THAT Andersen!
The plot of the series is she and her lil brother are trying to modify his fables to make them better.

No.38388 - Link Reply Report 38388 2
Source: https://www.youtube.com/watch?v=ogcJ0YtmapA

>>38373 Answer in Source

File: tumblr_lx3rz2UObd1qdtw9eo1_500.png -(331533 B, 427x614)
331533 331533 No.38402 - Link Reply Report 38402 2
File: 21230.jpg -(59630 B, 600x337)
59630 59630 No.38417 - Link Reply Report 38417 2

Like Scrooge Mc.Duck XD

File: 55b71ee484d2a04f96acf8c77083a994.jpg -(55292 B, 800x469)
55292 55292 No.38421 - Link Reply Report 38421 2

She looks like she realized she forgot to wear her panties.

File: gagged_blindfolded_noseplugged_and_earplugged.jpg -(115685 B, 1024x768)
115685 115685 No.38428 - Link Reply Report 38428 2
Source: https://www.youtube.com/watch?v=nMVlg-63a7A

>>38388 This comes from an episode on the side column.
For some reason they gagged theirself, blindfolded theirself, plugged their nose and their ears. I'd like to understand the context but I don't speak chinese.

File: blinkynutsy_cmp_pose013_20130927_a_v001-2.jpg -(25797 B, 655x368)
25797 25797 No.38456 - Link Reply Report 38456 2

I'm not sure if I like this redesign

File: tumblr_nycnt7kKgg1sbgdg5o1_400.jpg -(213574 B, 400x240)
213574 213574 No.38461 - Link Reply Report 38461 2
File: s.gif -(41857 B, 279x200)
41857 41857 No.38465 - Link Reply Report 38465 2
File: wild-over-you.jpg -(56684 B, 450x316)
56684 56684 No.38466 - Link Reply Report 38466 2

The frenchish here is priceless XD

File: kung-fu-bunny.jpg -(46711 B, 620x348)
46711 46711 No.38468 - Link Reply Report 38468 2

think of these shorts as Tom and Jerry meets amazing world of gumball.

File: [M-KV2501]_Egyxos_1x08_[WEBRip]_[1080p].mkv_snapshot_01.15_[2016.10.22_00.55.09].jpg -(293426 B, 1920x1080)
293426 293426 No.38474 - Link Reply Report 38474 2

Wonder if anyone heard of this new italian cartoon called Egyxos - guy finds out he is the last descendant of pharaohs who live in an odd parallel world. And yes, tons of anthros... most noteably an incredibly sexy Sekhmet, who is the mad scientist type for the bad guys, coming up with new weapons.

File: [M-KV2501]_Egyxos_1x22_[WEBRip]_[1080p].mkv_snapshot_15.02_[2016.10.22_01.20.29].jpg -(155220 B, 1920x1080)
155220 155220 No.38475 - Link Reply Report 38475 2

Sekhmet looks amazing. Great design.

File: [M-KV2501]_Egyxos_1x01_[WEBRip]_[1080p].mkv_snapshot_12.32_[2016.10.22_00.17.07].jpg -(206078 B, 1920x1080)
206078 206078 No.38477 - Link Reply Report 38477 2

Horus is the good pharaoh Kefer's friend, oddly he only has wings in his powered up golden form.

File: [M-KV2501]_Egyxos_1x09_[WEBRip]_[1080p].mkv_snapshot_03.19_[2016.10.22_01.04.47].jpg -(127808 B, 1920x1080)
127808 127808 No.38478 - Link Reply Report 38478 2

Anubis is one of the main villains (he has a human form too), as is... Thoth??? Yeah, he is the main advisor to the evil Pharaoh Exaton. He also has teeth, despite being a bird.

File: [M-KV2501]_Egyxos_1x06_[WEBRip]_[1080p].mkv_snapshot_01.45_[2016.10.22_00.50.21].jpg -(305188 B, 1920x1080)
305188 305188 No.38479 - Link Reply Report 38479 2

Sobek is a recurring villain, a sneaky traitor who once worked for the good pharaoh but betrayed that side to Exaton.

File: [M-KV2501]_Egyxos_1x19_[WEBRip]_[1080p].mkv_snapshot_00.32_[2016.10.22_00.21.08].jpg -(128504 B, 1920x1080)
128504 128504 No.38480 - Link Reply Report 38480 2

A super sexy Bastet appears in episode 19, too. :) She is forced to assassinate Kefer because Exaton keeps her daughter hostage.

File: [M-KV2501]_Egyxos_1x19_[WEBRip]_[1080p].mkv_snapshot_12.04_[2016.10.22_00.36.50].jpg -(270202 B, 1920x1080)
270202 270202 No.38481 - Link Reply Report 38481 2

Yes, you heard that right, Bastet has a daughter called Kira... LOL! I wonder who the father might be.
Horus does seem to be pretty smitten with Bastet, regardless.

File: [M-KV2501]_Egyxos_1x08_[WEBRip]_[1080p].mkv_snapshot_09.43_[2016.10.22_00.56.42].jpg -(235967 B, 1920x1080)
235967 235967 No.38482 - Link Reply Report 38482 2

Also Seth is on the side of the good guys... It's like these people knew nothing about the mythology they worked with.

File: [M-KV2501]_Egyxos_1x08_[WEBRip]_[1080p].mkv_snapshot_15.30_[2016.10.22_01.00.40].jpg -(168196 B, 1920x1080)
168196 168196 No.38483 - Link Reply Report 38483 2


Would help if you provided the source. I check Kisscartoons daily and I never heard of a Minions cartoon series...

File: [M-KV2501]_Egyxos_1x19_[WEBRip]_[1080p].mkv_snapshot_18.27_[2016.10.22_00.43.20].jpg -(176037 B, 1920x1080)
176037 176037 No.38484 - Link Reply Report 38484 2

Bastet with Kira.

File: c_1477128255793.jpg -(31257 B, 476x360)
31257 31257 No.38485 - Link Reply Report 38485 2

>>38474 Are you sure the show is italian? I googled for it and I saw the protagonist plays basketball. I thought football was the main sport in Italy.
<<Speaking of that, this screenshot comes from the episode "Sunny Italy" of Mighty Mouse cartoons.
Gotta love how it's just a half step from a panty shot.

File: Zig___Sharko.jpg -(134070 B, 1920x1080)
134070 134070 No.38489 - Link Reply Report 38489 2
Source: https://www.youtube.com/watch?v=WlcUmAHWMZY

>>38485 Football? You mean "soccer".
Also, here's a very hilarious cartoon.

File: oni3.jpg -(102189 B, 960x544)
102189 102189 No.38496 - Link Reply Report 38496 2
File: Wonder_Woman__2016-__007-013.jpg -(1556115 B, 1988x3056)
1556115 1556115 No.38504 - Link Reply Report 38504 2

Love the new design of Cheetah from DC Rebirth. She is more anthro-looking.


It's called soccer. :D And we in Europe play basketball too. And yeah, show is italian. I'd post the is the homepage (in italian) but the stupid link-block is STILL working, after what, 3 years? Does this place even has mods anywhere?
www egyxos com

File: vlcsnap-2014-12-04-19h55m47s193-450x337.png -(248081 B, 450x337)
248081 248081 No.38509 - Link Reply Report 38509 2
Source: http://www.animenation.net/obscure-object-of-uncertain-desire/
File: unidentified_furry_from_unidentified_source.jpg -(59284 B, 960x720)
59284 59284 No.38510 - Link Reply Report 38510 2
File: AoStH_Breezie_2.png -(822499 B, 919x703)
822499 822499 No.38547 - Link Reply Report 38547 2


File: Disney_Secrets_animatedfilmreviews.filminspector.com_7.png -(312273 B, 650x319)
312273 312273 No.38555 - Link Reply Report 38555 2

Holy crossover!

File: Hop-disneyscreencaps.com-8169.jpg -(316070 B, 1920x1040)
316070 316070 No.38574 - Link Reply Report 38574 2
File: InstantMartianchicks.jpg -(60188 B, 1023x570)
60188 60188 No.38584 - Link Reply Report 38584 2

Is there a better version of this?

File: fb567d9c841243630f64a916c294909a.jpg -(44081 B, 640x480)
44081 44081 No.38597 - Link Reply Report 38597 2

From Eto Rangers i think.

File: _156_108172422.jpg -(64330 B, 1024x738)
64330 64330 No.38617 - Link Reply Report 38617 2
Source: http://www.funnylla.com/pieces-of-art-you-wouldnt-believe-theyre-made-by-one-person.html
No.38618 - Link Reply Report 38618 2

too bad the Disney one was wholly due to saving money, they recycled animation and character designs all the time. Check out their version of robin hood then watch the Jungle book.. yep Little John is a Baloo recolor they look, move, talk and even act pretty much the same. except Baloo is grey and John is brown. most animals of the same species from older Disney all look the same and use the same animation, colors and accessories are the only difference.
Though for the sake of argument Lady and the Tramp's location is never disclosed and both have the same looking backgrounds, they could easily be in the same location at the same general time. Making that the same Scotti dog not just because they look the same,

No.38619 - Link Reply Report 38619 2


I'm pretty sure everybody knows that already.

File: 142-010flip.jpg -(23677 B, 635x478)
23677 23677 No.38620 - Link Reply Report 38620 2


But, how many know about the 1939 Terrytoons short, "A Wicky Wacky Romance"? My first thought was that this screenshot would be great for one of those out-of-context-screenshots threads, until it dawned on me that it isn't out of context at all and the implied threat of rape here is actually intentional...

File: 142-011react.jpg -(22523 B, 638x480)
22523 22523 No.38621 - Link Reply Report 38621 2

...yep, that looks like some attempted rape happening right there.

File: vlcsnap-2015-07-02-14h10m53s559.png -(177264 B, 640x480)
177264 177264 No.38622 - Link Reply Report 38622 2

Because these were not cartoons aimed at childrens.
No cartoon was infact originally aimed at young targed before toy sellers realized they could use those to promote their toys.
<<Look at this mousette for example.

File: vlcsnap-2015-07-02-14h11m18s878.png -(183191 B, 640x480)
183191 183191 No.38623 - Link Reply Report 38623 2
File: vlcsnap-2015-07-02-14h11m59s973.png -(172509 B, 640x480)
172509 172509 No.38624 - Link Reply Report 38624 2
No.38625 - Link Reply Report 38625 2


I want to see Little John and Baloo performing various acts upon each other. Why hasn't this been drawn yet?

File: Colleen.png -(386878 B, 960x720)
386878 386878 No.38641 - Link Reply Report 38641 2
File: Dr._Hutchison.png -(764847 B, 960x720)
764847 764847 No.38642 - Link Reply Report 38642 2
File: Sapphire.png -(333219 B, 854x480)
333219 333219 No.38643 - Link Reply Report 38643 2
File: tumblr_nrcvq3sBB71qhansmo6_1280.jpg -(141673 B, 1280x719)
141673 141673 No.38644 - Link Reply Report 38644 2

Lola hot again?

File: 78c7ba1833248c71119277b917839185.jpg -(219250 B, 1280x957)
219250 219250 No.38646 - Link Reply Report 38646 2
File: Pikiinya.jpg -(584887 B, 1280x1133)
584887 584887 No.38647 - Link Reply Report 38647 2

I'm posting this here in the hope someone might know more about this cheetah character from an old Super Famicom game called Pikiinya!, specifically a clue to their gender? S/he certainly has a feminine body and look, but seems to be lacking developed breasts... if anyone here could read Japanese and do a quick translate it would be much appreciated.

File: tumblr_mjp18hP4HZ1s1na2eo2_1280.jpg -(182066 B, 640x1158)
182066 182066 No.38648 - Link Reply Report 38648 2
Source: http://hydao.tumblr.com/post/45409295788/pikinya-or-pikiinya-1997-super-famicom

>>38647 Flat chested girls are so understimated.
<<A reverse image search gave me this.

No.38649 - Link Reply Report 38649 2

>>38648 Found the game online: www. loveroms. com/play-online/super-nintendo/pikiinya-j/103179
If you can reach the cheetah babe post screenshots.

File: PikiinyaPuzzle.png -(131696 B, 1024x768)
131696 131696 No.38663 - Link Reply Report 38663 2


Thanks, I tried playing but I suck at Tetris style puzzle games. I was able to find sprite sheets online though. I was also able to translate the Katakana of her name as "Nikeeta", or possibly "Nikeetah" since the ending half of her name matches to the Japanese writing for the last half of the word "cheetah".

File: af62dda0.jpg -(33606 B, 800x450)
33606 33606 No.38680 - Link Reply Report 38680 2

Translation, please?

File: An_important_achievement_in_Zootopia.jpg -(65001 B, 638x820)
65001 65001 No.38685 - Link Reply Report 38685 2
File: D_056_01.jpg -(502630 B, 986x1526)
502630 502630 No.38686 - Link Reply Report 38686 2

Oedi and Cookie from Dreadstar... why did I never hear about this comic before?

File: sonic_satam_sonic_and_sally_in_love_by_darkramiess-d7zdw1d.jpg -(77771 B, 640x480)
77771 77771 No.38696 - Link Reply Report 38696 2
File: SparksterSherry_Devotindos.png -(448218 B, 603x451)
448218 448218 No.38707 - Link Reply Report 38707 2
File: my_play_through_of_rocket_knight_adventures_by_kila_ogoichi-d5jzg89.jpg -(59162 B, 318x223)
59162 59162 No.38717 - Link Reply Report 38717 2
File: 01VFOQW.jpg -(141306 B, 1920x1080)
141306 141306 No.38756 - Link Reply Report 38756 2

<<What anime is this?

File: DND1.png -(342044 B, 847x429)
342044 342044 No.38784 - Link Reply Report 38784 2
Source: https://www.youtube.com/watch?v=oItIwiQUxGM
File: DND2.png -(361987 B, 847x429)
361987 361987 No.38785 - Link Reply Report 38785 2


File: m2-thumb.jpg -(10346 B, 150x180)
10346 10346 No.38786 - Link Reply Report 38786 2


Can't find the full pic, if anyone have it,
please share it.

File: Sid_s_granny_young.png -(428194 B, 783x326)
428194 428194 No.38816 - Link Reply Report 38816 2
File: Sands_of_Destruction_wolf.jpg -(65379 B, 1440x900)
65379 65379 No.38820 - Link Reply Report 38820 2

Maybe Sands of Destruction? I never watched more than two episodes, it was rather full of anime cliches. Style does look similar.

File: The.Adventures.Of.Puss.In.Boots.S04E04.720p.WEBRip.x264-eSc.mkv_snapshot_20.25_[2016.12.20_18.15.23].jpg -(100295 B, 1280x720)
100295 100295 No.38821 - Link Reply Report 38821 2

Honestly, I get more reactions and comments on plus4chan so I barely post here these days... but seriously, is no-one posting about Alessandra from Puss in Boots? She is right there with Tigress in that Dreamworks style.

File: The.Adventures.Of.Puss.In.Boots.S04E09.720p.WEBRip.x264-eSc.mkv_snapshot_14.20_[2016.12.21_18.17.59].jpg -(63086 B, 1280x720)
63086 63086 No.38822 - Link Reply Report 38822 2

Also, Roz, Pajuna's old mercenary partner. Bebop would be all over her. :)

File: Képernyőfelvétel__2681.png -(1332142 B, 1920x1080)
1332142 1332142 No.38823 - Link Reply Report 38823 2

From episode 4 of Sands of Destruction

File: Képernyőfelvétel__2684.png -(2157513 B, 1920x1080)
2157513 2157513 No.38824 - Link Reply Report 38824 2

Sadly most of the main character beastmen just look like humans with cat ears and tails, or are cartoony animals on 2 legs. The bakcground characters are better anthros than them.

File: Képernyőfelvétel__2686.png -(633740 B, 1920x1080)
633740 633740 No.38825 - Link Reply Report 38825 2

A relative to Stallion from Wordsworth, no doubt. :D

File: Képernyőfelvétel__2705.png -(1144012 B, 1920x1080)
1144012 1144012 No.38826 - Link Reply Report 38826 2

LOL... evil Winnie the Pooh?

File: Képernyőfelvétel__2713.png -(1598595 B, 1920x1080)
1598595 1598595 No.38827 - Link Reply Report 38827 2

Nice big rhino gal. From episode 6

File: tumblr_oiczqw3PiQ1rltdv0o1_1280.jpg -(64133 B, 1200x675)
64133 64133 No.38828 - Link Reply Report 38828 2
File: tumblr_oiczqw3PiQ1rltdv0o2_1280.jpg -(70078 B, 1200x675)
70078 70078 No.38829 - Link Reply Report 38829 2
File: Képernyőfelvétel__2723.png -(1292163 B, 1920x1080)
1292163 1292163 No.38830 - Link Reply Report 38830 2

Alligator Master, from episode 10

File: Képernyőfelvétel__2784.png -(2177465 B, 1920x1080)
2177465 2177465 No.38831 - Link Reply Report 38831 2

Eagle Master, another of the main antagonists

File: 3cfdb59de7efe65389f913df0733ef3f7a03dec5.png -(769823 B, 1280x720)
769823 769823 No.38832 - Link Reply Report 38832 2
No.38834 - Link Reply Report 38834 2


Re:Zero -Starting Life in Another World-/Re:Zero kara Hajimeru Isekai Seikatsu

No.38835 - Link Reply Report 38835 2


Re:Zero kara Hajimeru Isekai Seikatsu

File: tumblr_inline_mxclqpR96V1rjm3a5.png -(290309 B, 500x375)
290309 290309 No.38843 - Link Reply Report 38843 2
File: Wendy_messes_up_Lucario.jpg -(78482 B, 800x450)
78482 78482 No.38880 - Link Reply Report 38880 2
File: 1024x759-150812054253-1024.The-Lion-Guard-JR-81215.jpg -(151459 B, 1024x759)
151459 151459 No.38899 - Link Reply Report 38899 2
File: ratclonesx.png -(987369 B, 1600x900)
987369 987369 No.38904 - Link Reply Report 38904 2

Ratchet and Clank Size Matters

look up Elite Ratchet Clones for info

File: __lady_cat__1_by_mabmb1987-damvi70.png -(1806687 B, 1565x1058)
1806687 1806687 No.38926 - Link Reply Report 38926 2
File: __lady_cat__2_by_mabmb1987-damviyq.png -(1046646 B, 959x889)
1046646 1046646 No.38927 - Link Reply Report 38927 2
File: __lady_cat__3_by_mabmb1987-damvi6b.png -(893316 B, 836x901)
893316 893316 No.38928 - Link Reply Report 38928 2
File: __lady_cat__4_by_mabmb1987-damvi66.png -(1185556 B, 1298x1028)
1185556 1185556 No.38929 - Link Reply Report 38929 2
File: Super-Mario-Odyssey-Reveal-Trailer-6.jpg -(70481 B, 1024x590)
70481 70481 No.38935 - Link Reply Report 38935 2

I dig the female bunny <3

File: Hop-disneyscreencaps.com-3234.jpg -(474049 B, 1920x1040)
474049 474049 No.38939 - Link Reply Report 38939 2

The prototypes of Judy Hopps from the movie... Hop

No.38945 - Link Reply Report 38945 2

How exactly? Hop is owned by Universal and Zootopia is a Disney Film.
Yea this screen cap fits the thread but the bunnies from Hop have nothing to do with Judy other than also being CGI animated Rabbits, the animators wouldn't have access to a competing studio's assets.

File: by_trixieluz-d529ei5.png -(256355 B, 830x347)
256355 256355 No.38949 - Link Reply Report 38949 2

>>38945 It was a joke!!

File: ultra-street-fighter-iv-wild-sagat.jpg -(383842 B, 1280x720)
383842 383842 No.38953 - Link Reply Report 38953 2

>>38949 Poe's law at work

File: maxresdefault_ghostb.jpg -(76435 B, 1280x720)
76435 76435 No.38968 - Link Reply Report 38968 2

ghostbusters iso game got ghost Furies? XD

No.38972 - Link Reply Report 38972 2

I consider slaying the trope "all animation is Disney" worth killing a weak joke.

File: b46cd1ff1d840d2705d0a142e4103da32a90ebd21129009353c3ecfccf84d205.jpg -(51497 B, 640x360)
51497 51497 No.38992 - Link Reply Report 38992 2
File: 006631a5924f274c090105851a725a72cebaa139c106100e4f8d9115dbaf9759.jpg -(62310 B, 700x400)
62310 62310 No.38993 - Link Reply Report 38993 2
File: 2e78f2f95fe8ae28f6490cbe343946aa1898dce26b6039faac21c3db89f9f73c.jpg -(66633 B, 768x576)
66633 66633 No.38994 - Link Reply Report 38994 2
File: jewelpet-kira-deco_05-00.jpg -(60208 B, 1280x720)
60208 60208 No.39001 - Link Reply Report 39001 2
Source: https://53rg10.wordpress.com/2012/05/06/jewelpet-kira-deco-morning-wake-up-call/
File: S6E11.149_Go_big_or_go_home.png -(862779 B, 842x473)
862779 862779 No.39031 - Link Reply Report 39031 2

Did you know that the name of Mordecai's Mom is Hilary? According to Calvin Wong, one of the writers of Regular Show, the name of Mordecai's Mom is named after the storyboard artist, Hilary Florido.

File: nyanta_log_horizon_1.jpg -(89151 B, 1024x576)
89151 89151 No.39101 - Link Reply Report 39101 2
File: nyanta_log_horizon_2.jpg -(100400 B, 1024x576)
100400 100400 No.39102 - Link Reply Report 39102 2
File: nyanta_log_horizon_3.jpg -(88584 B, 1024x576)
88584 88584 No.39103 - Link Reply Report 39103 2
File: nyanta_log_horizon_4.jpg -(110031 B, 1024x577)
110031 110031 No.39104 - Link Reply Report 39104 2
File: Cat_Food.png -(781575 B, 1000x563)
781575 781575 No.39136 - Link Reply Report 39136 2
File: 2_6.jpg -(25968 B, 256x384)
25968 25968 No.39288 - Link Reply Report 39288 2
Source: https://www.gamefaqs.com/ds/924899-daigasso-band-brothers/images

Bedroom eyes <3

File: 2_4.jpg -(22563 B, 256x384)
22563 22563 No.39289 - Link Reply Report 39289 2
Source: https://www.gamefaqs.com/ds/924899-daigasso-band-brothers/images

How comes she's barely known?

File: muzzledhorse.png -(4049443 B, 1440x2700)
4049443 4049443 No.39303 - Link Reply Report 39303 2


File: Snapshot_dvd_19.50_-2011.11.12_23.07.22-.jpg -(147889 B, 640x480)
147889 147889 No.39330 - Link Reply Report 39330 2


File: c_1489320014326.jpg -(135835 B, 540x720)
135835 135835 No.39405 - Link Reply Report 39405 2
File: 1630811_-_Kazenui_Mynx_Toukiden.jpg -(134412 B, 960x544)
134412 134412 No.39447 - Link Reply Report 39447 2
File: 1630810_-_Kazenui_Mynx_Toukiden.jpg -(146799 B, 960x544)
146799 146799 No.39448 - Link Reply Report 39448 2
File: c_1490038496204.png -(2187394 B, 615x1487)
2187394 2187394 No.39449 - Link Reply Report 39449 2
File: ep58_10.jpg -(52719 B, 640x480)
52719 52719 No.39469 - Link Reply Report 39469 2

Is Cream looking where I think she's looking?

File: Mario_AlHaddaf_HQ_22.avi_snapshot_08.05_[2017.04.17_21.49.13].jpg -(44319 B, 720x576)
44319 44319 No.39522 - Link Reply Report 39522 2

From Forza Mario/Hidemaru, Cleo and Patra, sexy lynx girl soccer team captains.

File: Mario_AlHaddaf_HQ_22.avi_snapshot_15.25_[2017.04.17_21.57.52].jpg -(74653 B, 720x576)
74653 74653 No.39523 - Link Reply Report 39523 2

Heck, their whole soccer team is composed of sexy lynx girls. Imagine the after-match shower scenes...

File: 1780004_-_Kazenui_Mynx_Toukiden.jpg -(80676 B, 488x425)
80676 80676 No.39524 - Link Reply Report 39524 2

These are ancient. Why are you reposting them instead of finding new material? Can't anyone find the guy who did the CGI model, for example? Or the design artist?
me, here is the latest thing I could find, not sure from what, probably a manga or instruction for the game.

File: Mario_AlHaddaf_HQ_22.avi_snapshot_18.49_[2017.04.17_22.03.16].jpg -(60469 B, 720x576)
60469 60469 No.39525 - Link Reply Report 39525 2

HUh, I missed this! Niiiice! Thanks for providing a link too. :)

File: Cleo.jpg -(24699 B, 130x270)
24699 24699 No.39526 - Link Reply Report 39526 2


Source of this? Looks like Mighty Mouse's style...

File: Patra.jpg -(24565 B, 135x270)
24565 24565 No.39527 - Link Reply Report 39527 2

That show has like 45 episode or so. I don't wanna have to look through all of them... which one has the anthros?

File: Ricardo_Welkin_Anime.png -(3218713 B, 1920x1080)
3218713 3218713 No.39528 - Link Reply Report 39528 2

I was only able to find one named anthro from Re-zero, this guy named Ricardo, and there is barely any information on him too. Despite there being anthro species in this anime, as usual, all the main characters are boring humans and elves.

File: Mario_AlHaddaf_HQ_04.avi_snapshot_13.40_[2014.07.12_11.37.28].jpg -(40620 B, 720x576)
40620 40620 No.39529 - Link Reply Report 39529 2

Seriously, would it kill you to name a SOURCE? Where are all these cat ladies from?

For the record, the Lynx Soccer team are in episode 22 of Forza Mario. As for Flora - this gal - she is in pretty much every episode after the 4th

No.39530 - Link Reply Report 39530 2

Character's NAME., what MOVIE/SHOW she is from. it's not fucking hard to type, people. Otherwise, why are you posting the pics without context?

File: legend-of-zelda-twilight-princess-hd-01.jpg -(275806 B, 1920x1080)
275806 275806 No.39538 - Link Reply Report 39538 2

Midna and Wolf Link from The Legend Of Zelda: Twilight Princess

File: amy_rose_the_hedgehog_by_tanyatackett-d96tjab.jpg -(58928 B, 992x557)
58928 58928 No.39540 - Link Reply Report 39540 2
File: c_1494490752610.png -(2056659 B, 1372x1150)
2056659 2056659 No.39593 - Link Reply Report 39593 2
File: c_1494490905077.png -(326041 B, 720x407)
326041 326041 No.39594 - Link Reply Report 39594 2

From Shirokuma Cafe

File: New_Pork_Beach.jpg -(115617 B, 1250x370)
115617 115617 No.39599 - Link Reply Report 39599 2

What cartoon is this?

File: 6cea8a67b1599b3e9eab5ea752a5338e.jpg -(161480 B, 1000x563)
161480 161480 No.39606 - Link Reply Report 39606 2

Is this Monster Hunter?

File: fat-bugs-bunny.jpg -(126019 B, 1280x720)
126019 126019 No.39664 - Link Reply Report 39664 2
File: blinky_says_goodbye_penelope_by_blinkybillfan-da1r824.jpg -(67783 B, 1024x812)
67783 67783 No.39690 - Link Reply Report 39690 2

Damn! His face is such into a soft place <3

File: 35e9ecf379f592f214b6bcd10a72bd39.jpg -(234414 B, 1279x721)
234414 234414 No.39691 - Link Reply Report 39691 2

What cartoon is this?

File: Knuckles_Sneaks_a_Peek.jpg -(123798 B, 500x375)
123798 123798 No.39773 - Link Reply Report 39773 2

>>38347 & Knuckles

File: c_1499198189981.jpg -(358236 B, 1280x720)
358236 358236 No.39790 - Link Reply Report 39790 2
File: Anthro_Jade.png -(256753 B, 686x495)
256753 256753 No.39792 - Link Reply Report 39792 2
File: Evil_Coco_model_that_never_made_it_into_the_final_game.png -(291661 B, 860x480)
291661 291661 No.39793 - Link Reply Report 39793 2
File: dbsu4p3.png -(190644 B, 350x573)
190644 190644 No.39814 - Link Reply Report 39814 2

Dragon Ball Super Universe 4 team

File: dbsu4p4.png -(798448 B, 1600x900)
798448 798448 No.39815 - Link Reply Report 39815 2
File: dbsu4p5.png -(636490 B, 1600x900)
636490 636490 No.39816 - Link Reply Report 39816 2
File: c_1500726890374.jpg -(183520 B, 608x465)
183520 183520 No.39853 - Link Reply Report 39853 2

Do you know who she is and what series she comes from?

File: c_1500726881835.png -(157505 B, 399x407)
157505 157505 No.39854 - Link Reply Report 39854 2

Do you know who she is and what series she comes from?

File: The.Adventures.of.Puss.in.Boots.S05E10.1080p.Netflix.WEB-DL.DD5.1.x264-QOQ.mkv_snapshot_04.33_[2017.08.04_22.48.47].jpg -(259756 B, 1920x1080)
259756 259756 No.39894 - Link Reply Report 39894 2

Sheila the dingo from Adventures of Puss in Boots (S05E10). Think I am in love again! :D

File: Sheila-GIF1.gif -(5583789 B, 343x338)
5583789 5583789 No.39895 - Link Reply Report 39895 2

Even made a GIF of her. :)

Despite the sleek look, he is a guy. Name is Majora.

No, look around this site, we have posted tons of pics of her already. She is Kazenui (aka Mynx) from Toukiden Kiwami.

File: The.Adventures.of.Puss.in.Boots.S05E10.1080p.Netflix.WEB-DL.DD5.1.x264-QOQ.mkv_snapshot_04.55_[2017.08.04_23.20.17].jpg -(269738 B, 1920x1080)
269738 269738 No.39896 - Link Reply Report 39896 2
File: dingodancesmalezgif-4-cdfe15f4b5.gif -(2665222 B, 600x338)
2665222 2665222 No.39897 - Link Reply Report 39897 2
File: c_1502090927822.jpg -(112208 B, 1566x654)
112208 112208 No.39911 - Link Reply Report 39911 2
File: c_1502836510890.jpg -(66580 B, 810x478)
66580 66580 No.39933 - Link Reply Report 39933 2
File: c_1503306538228.hypercat-z_that_fox_from_arms.jpg -(167610 B, 1200x675)
167610 167610 No.39957 - Link Reply Report 39957 2
File: d1a04e2fb0d9dfec7671b920abd04b75.jpg -(131236 B, 1920x1080)
131236 131236 No.39959 - Link Reply Report 39959 2
File: Fantastic_Mr_Fox_4.jpg -(276998 B, 1600x1034)
276998 276998 No.39960 - Link Reply Report 39960 2
File: vlcsnap-2016-10-13-11h18m45s130.png -(1157495 B, 1280x720)
1157495 1157495 No.39973 - Link Reply Report 39973 2

Speeder and his grandpa from Vroomiz, season 2

File: Roxanne_in_Ducktales_2017.jpg -(35644 B, 680x383)
35644 35644 No.40074 - Link Reply Report 40074 2
File: 38sonic06.jpg -(73934 B, 790x560)
73934 73934 No.40100 - Link Reply Report 40100 2

Kid Bunnie Rabbot is so cute <3

File: Para-Dice.jpg -(136478 B, 640x480)
136478 136478 No.40133 - Link Reply Report 40133 2
File: ducktales4-lena01.jpg -(320726 B, 2760x1560)
320726 320726 No.40138 - Link Reply Report 40138 2
File: DNqVq4PUQAAnuny.jpg -(185455 B, 1280x720)
185455 185455 No.40172 - Link Reply Report 40172 2
File: live48162_aoar-running-sequence-1.jpg -(40428 B, 947x198)
40428 40428 No.40203 - Link Reply Report 40203 2
File: butthug.png -(1265007 B, 1920x1080)
1265007 1265007 No.40208 - Link Reply Report 40208 2
File: Hop-disneyscreencaps.com-8753.jpg -(375433 B, 1920x1040)
375433 375433 No.40246 - Link Reply Report 40246 2
File: SmileThrottle.png -(927271 B, 1600x900)
927271 927271 No.40250 - Link Reply Report 40250 2
File: chipettes_2.png -(208325 B, 350x263)
208325 208325 No.40251 - Link Reply Report 40251 2

What episode was this?

File: NPlAnEm.jpg -(288973 B, 1920x1080)
288973 288973 No.40260 - Link Reply Report 40260 2

What game is this?

File: b1dVtgD.jpg -(55914 B, 320x240)
55914 55914 No.40346 - Link Reply Report 40346 2

Turtle Hero TV 12

File: v10NbMF.jpg -(56680 B, 320x240)
56680 56680 No.40347 - Link Reply Report 40347 2

Turtle Hero TV 12

File: 639OpMH.jpg -(55196 B, 320x240)
55196 55196 No.40348 - Link Reply Report 40348 2

Turtle Hero TV 12

No.40353 - Link Reply Report 40353 2

The game in that screenshot is Guild Wars 2, those are asura

File: Cat_Monster-pan.jpg -(735645 B, 1387x2019)
735645 735645 No.40418 - Link Reply Report 40418 2

I swear people, I have more reactions on Plus4chan to what I post than here. It's why I have not been here for ages... this place is pretty dead.
Anyway, thought I'd still mention her - from Hot Streets, episode 5.

No.40450 - Link Reply Report 40450 2

See [adult swim] logo on the corner
That is really a screenshot and not just a furry pic straight from Deviant Art?
I've mixed feelings about that °_°

File: Krystal.jpg -(186457 B, 1280x720)
186457 186457 No.40722 - Link Reply Report 40722 2

She's back <3

File: SSB4-Wii_U_Congratulations_All-Star_Pikachu.png -(1331744 B, 1600x900)
1331744 1331744 No.40732 - Link Reply Report 40732 2
File: Aggretsuko__TBS_Jap__E-_Muscles_02.png -(1007962 B, 1366x768)
1007962 1007962 No.40735 - Link Reply Report 40735 2
File: c_1538120353778.jpg -(257248 B, 986x810)
257248 257248 No.40887 - Link Reply Report 40887 2
File: a44da3c0a95968ac616f8518471191e8.jpg -(33268 B, 480x360)
33268 33268 No.40889 - Link Reply Report 40889 2
File: DW9qgYdV4AAI1vf.jpg -(59191 B, 920x686)
59191 59191 No.40903 - Link Reply Report 40903 2
File: 1c6fb39ebdcb6736e05f3cbc38eb8d58.jpg -(40922 B, 640x480)
40922 40922 No.40906 - Link Reply Report 40906 2